| Reaction Details |
|---|
 | Report a problem with these data |
| Target | POsterior Segregation |
|---|
| Ligand | BDBM52881 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA |
|---|
| EC50 | 41641±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| POsterior Segregation |
|---|
| Name: | POsterior Segregation |
|---|
| Synonyms: | POsterior Segregation family member (pos-1) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 29838.90 |
|---|
| Organism: | Caenorhabditis elegans |
|---|
| Description: | gi_17562800 |
|---|
| Residue: | 264 |
|---|
| Sequence: | MADNDFLSGEAIMVFKKEILDSHSDFTRSLSHQSASPEAYDQENVFSQDFQPFMKQDKET
QNSASQPTSEQSLANRDPCTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCR
FAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNAAKLASGA
HANTSSKSPARNAAAHNHSLFVPQGSTDRSMDLNQSLPIRQSDLVRAFARATRLDVSGYN
STAQLAQYFESQFQRIQQLSSHHH
|
|
|
|---|
| BDBM52881 |
|---|
| n/a |
|---|
| Name | BDBM52881 |
|---|
| Synonyms: | (3-butyl-7-methyl-6,8-dioxoisochromen-7-yl) 3-phenylpropanoate | 3-phenylpropanoic acid (3-butyl-7-methyl-6,8-dioxo-2-benzopyran-7-yl) ester | 3-phenylpropionic acid (3-butyl-6,8-diketo-7-methyl-isochromen-7-yl) ester | CMLD003367 | MLS000438292 | SMR000452561 | [3-butyl-7-methyl-6,8-bis(oxidanylidene)isochromen-7-yl] 3-phenylpropanoate | cid_16745546 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24O5 |
|---|
| Mol. Mass. | 380.4337 |
|---|
| SMILES | CCCCC1=CC2=CC(=O)C(C)(OC(=O)CCc3ccccc3)C(=O)C2=CO1 |c:27,t:4,6| |
|---|
| Structure | 
|
|---|
Search and Browse
