| Reaction Details |
|---|
 | Report a problem with these data |
| Target | POsterior Segregation |
|---|
| Ligand | BDBM52886 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA |
|---|
| EC50 | 50248±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescent Polarization Homogeneous Dose Response HTS to Indentify Inhibitors of POS-1 Binding to mex-3-RNA PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| POsterior Segregation |
|---|
| Name: | POsterior Segregation |
|---|
| Synonyms: | POsterior Segregation family member (pos-1) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 29838.90 |
|---|
| Organism: | Caenorhabditis elegans |
|---|
| Description: | gi_17562800 |
|---|
| Residue: | 264 |
|---|
| Sequence: | MADNDFLSGEAIMVFKKEILDSHSDFTRSLSHQSASPEAYDQENVFSQDFQPFMKQDKET
QNSASQPTSEQSLANRDPCTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCR
FAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNAAKLASGA
HANTSSKSPARNAAAHNHSLFVPQGSTDRSMDLNQSLPIRQSDLVRAFARATRLDVSGYN
STAQLAQYFESQFQRIQQLSSHHH
|
|
|
|---|
| BDBM52886 |
|---|
| n/a |
|---|
| Name | BDBM52886 |
|---|
| Synonyms: | 4-O-[5-bromo-3-(4-methoxyphenyl)-7-methyl-6,8-dioxo-2-prop-2-enylisoquinolin-7-yl] 1-O-methyl butanedioate | CMLD004289 | MLS000438677 | O4-[5-bromanyl-3-(4-methoxyphenyl)-7-methyl-6,8-bis(oxidanylidene)-2-prop-2-enyl-isoquinolin-7-yl] O1-methyl butanedioate | SMR000452726 | butanedioic acid O4-[5-bromo-3-(4-methoxyphenyl)-7-methyl-6,8-dioxo-2-prop-2-enyl-7-isoquinolinyl] ester O1-methyl ester | cid_16745648 | succinic acid O4-[2-allyl-5-bromo-6,8-diketo-3-(4-methoxyphenyl)-7-methyl-7-isoquinolyl] ester O1-methyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H24BrNO7 |
|---|
| Mol. Mass. | 530.365 |
|---|
| SMILES | COC(=O)CCC(=O)OC1(C)C(=O)C(Br)=C2C=C(N(CC=C)C=C2C1=O)c1ccc(OC)cc1 |c:16,22,t:14| |
|---|
| Structure | 
|
|---|
Search and Browse
