Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM51782 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | uHTS absorbance assay for the identification of compounds that inhibit VHR1. |
---|
IC50 | 1230±n/a nM |
---|
Citation | PubChem, PC uHTS absorbance assay for the identification of compounds that inhibit VHR1. PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM51782 |
---|
n/a |
---|
Name | BDBM51782 |
Synonyms: | (5E)-5-(2-furanylmethylidene)-1-(2-methylphenyl)-2-sulfanylidene-1,3-diazinane-4,6-dione | (5E)-5-(2-furfurylidene)-1-(o-tolyl)-2-thioxo-hexahydropyrimidine-4,6-quinone | (5E)-5-(furan-2-ylmethylidene)-1-(2-methylphenyl)-2-sulfanylidene-1,3-diazinane-4,6-dione | MLS001163797 | SMR000539168 | cid_1557339 |
Type | Small organic molecule |
Emp. Form. | C16H12N2O3S |
Mol. Mass. | 312.343 |
SMILES | Cc1ccccc1N1C(=S)NC(=O)C(=Cc2ccco2)C1=O |w:14.15| |
Structure |
|