| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Ligand | BDBM61888 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide. |
|---|
| IC50 | 8772±n/a nM |
|---|
| Citation |  PubChem, PC Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of myeloid cell leukemia sequence 1 (MCL1) interactions with BIM-BH3 peptide. PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
|---|
| Type: | Membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 37332.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q07820 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
|---|
| BDBM61888 |
|---|
| n/a |
|---|
| Name | BDBM61888 |
|---|
| Synonyms: | MLS001141795 | N-[2-(2,3-dimethylanilino)-2-keto-ethyl]-3-pyrrol-1-yl-benzamide | N-[2-(2,3-dimethylanilino)-2-oxoethyl]-3-(1-pyrrolyl)benzamide | N-[2-(2,3-dimethylanilino)-2-oxoethyl]-3-pyrrol-1-ylbenzamide | N-[2-[(2,3-dimethylphenyl)amino]-2-oxidanylidene-ethyl]-3-pyrrol-1-yl-benzamide | SMR000709778 | cid_24980576 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21N3O2 |
|---|
| Mol. Mass. | 347.4103 |
|---|
| SMILES | Cc1cccc(NC(=O)CNC(=O)c2cccc(c2)-n2cccc2)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
