Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM40627 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of MCL1: fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of BCL2-related protein, long isoform (BCLXL). |
---|
IC50 | 108803±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of MCL1: fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of BCL2-related protein, long isoform (BCLXL). PubChem Bioassay(2009)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
Type: | Mitochondrion membrane; Single-pass membrane protein |
Mol. Mass.: | 26039.60 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM40627 |
---|
n/a |
---|
Name | BDBM40627 |
Synonyms: | (E)-3-amino-2-[1-oxo-2-[[5-(propan-2-ylamino)-1,3,4-thiadiazol-2-yl]thio]ethyl]-2-butenenitrile | (E)-3-amino-2-[2-[[5-(isopropylamino)-1,3,4-thiadiazol-2-yl]thio]acetyl]but-2-enenitrile | (E)-3-amino-2-[2-[[5-(propan-2-ylamino)-1,3,4-thiadiazol-2-yl]sulfanyl]acetyl]but-2-enenitrile | (E)-3-azanyl-2-[2-[[5-(propan-2-ylamino)-1,3,4-thiadiazol-2-yl]sulfanyl]ethanoyl]but-2-enenitrile | MLS000056676 | SMR000065414 | cid_5742574 |
Type | Small organic molecule |
Emp. Form. | C11H15N5OS2 |
Mol. Mass. | 297.4 |
SMILES | CC(C)Nc1nnc(SCC(=O)C(C#N)C(C)=N)s1 |
Structure |
|