| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM52965 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of MCL1: fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of BCL2-related protein, long isoform (BCLXL). |
|---|
| IC50 | 27252±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of MCL1: fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of BCL2-related protein, long isoform (BCLXL). PubChem Bioassay(2009)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | Mitochondrion membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 26039.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM52965 |
|---|
| n/a |
|---|
| Name | BDBM52965 |
|---|
| Synonyms: | 1-O-methyl 4-O-(7-methyl-6,8-dioxo-3-thiophen-3-ylisochromen-7-yl) butanedioate | CMLD003572 | MLS000438829 | O1-methyl O4-[7-methyl-6,8-bis(oxidanylidene)-3-thiophen-3-yl-isochromen-7-yl] butanedioate | SMR000452585 | butanedioic acid O1-methyl ester O4-[7-methyl-6,8-dioxo-3-(3-thiophenyl)-2-benzopyran-7-yl] ester | cid_16759464 | succinic acid O4-[6,8-diketo-7-methyl-3-(3-thienyl)isochromen-7-yl] ester O1-methyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16O7S |
|---|
| Mol. Mass. | 388.391 |
|---|
| SMILES | COC(=O)CCC(=O)OC1(C)C(=O)C=C2C=C(OC=C2C1=O)c1ccsc1 |c:15,18,t:13| |
|---|
| Structure | 
|
|---|
Search and Browse
