| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM62338 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SAR analysis of inhibitors of TNFa specific NF-kB induction revised |
|---|
| IC50 | 1360±n/a nM |
|---|
| Citation |  PubChem, PC SAR analysis of inhibitors of TNFa specific NF-kB induction revised PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM62338 |
|---|
| n/a |
|---|
| Name | BDBM62338 |
|---|
| Synonyms: | MLS-0425704.0001 | N-[1-(2-fluorophenyl)-4,5,6,7-tetrahydroindazol-4-yl]-5-(4-methoxyphenyl)-2-methyl-3-pyrazolecarboxamide | N-[1-(2-fluorophenyl)-4,5,6,7-tetrahydroindazol-4-yl]-5-(4-methoxyphenyl)-2-methyl-pyrazole-3-carboxamide | N-[1-(2-fluorophenyl)-4,5,6,7-tetrahydroindazol-4-yl]-5-(4-methoxyphenyl)-2-methylpyrazole-3-carboxamide | cid_44543509 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H24FN5O2 |
|---|
| Mol. Mass. | 445.4888 |
|---|
| SMILES | COc1ccc(cc1)-c1cc(C(=O)NC2CCCc3c2cnn3-c2ccccc2F)n(C)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
