| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|
| Ligand | BDBM41038 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) |
|---|
| IC50 | 22349±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|
| Name: | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|
| Synonyms: | PP-1A | PP1A_HUMAN | PPP1A | PPP1CA | Serine/threonine protein phosphatase PP1-alpha catalytic subunit | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | protein phosphatase 1, catalytic subunit, alpha isoform 3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37510.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_197827 |
|---|
| Residue: | 330 |
|---|
| Sequence: | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
|
|
|
|---|
| BDBM41038 |
|---|
| n/a |
|---|
| Name | BDBM41038 |
|---|
| Synonyms: | (NE)-N-[3-(2-methylanilino)-4-oxo-1-naphthalenylidene]-2-thiophenesulfonamide | (NE)-N-[3-(2-methylanilino)-4-oxonaphthalen-1-ylidene]thiophene-2-sulfonamide | (NE)-N-[3-[(2-methylphenyl)amino]-4-oxidanylidene-naphthalen-1-ylidene]thiophene-2-sulfonamide | (NE)-N-[4-keto-3-(o-toluidino)-1-naphthylidene]thiophene-2-sulfonamide | MLS000536576 | SMR000151472 | cid_11834470 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H16N2O3S2 |
|---|
| Mol. Mass. | 408.493 |
|---|
| SMILES | Cc1ccccc1NC1=CC(=NS(=O)(=O)c2cccs2)c2ccccc2C1=O |w:11.12,t:9| |
|---|
| Structure | 
|
|---|
Search and Browse
