Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
---|
Ligand | BDBM64779 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) |
---|
IC50 | 67047±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
---|
Name: | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
Synonyms: | PP-1A | PP1A_HUMAN | PPP1A | PPP1CA | Serine/threonine protein phosphatase PP1-alpha catalytic subunit | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | protein phosphatase 1, catalytic subunit, alpha isoform 3 |
Type: | PROTEIN |
Mol. Mass.: | 37510.66 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_197827 |
Residue: | 330 |
Sequence: | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
|
|
|
BDBM64779 |
---|
n/a |
---|
Name | BDBM64779 |
Synonyms: | (6Z)-6-(1,2-dihydro-1,2,3,4-tetrazol-5-ylidene)-4-nitro-cyclohexa-2,4-dien-1-one | (6Z)-6-(1,2-dihydrotetrazol-5-ylidene)-4-nitro-1-cyclohexa-2,4-dienone | (6Z)-6-(1,2-dihydrotetrazol-5-ylidene)-4-nitro-cyclohexa-2,4-dien-1-one | (6Z)-6-(1,2-dihydrotetrazol-5-ylidene)-4-nitrocyclohexa-2,4-dien-1-one | 4-nitro-2-(2H-tetraazol-5-yl)phenol | MLS000540078 | SMR000162423 | cid_11839800 |
Type | Small organic molecule |
Emp. Form. | C7H5N5O3 |
Mol. Mass. | 207.1463 |
SMILES | [O-][N+](=O)c1ccc(=O)[c-](c1)-c1[nH]nn[nH+]1 |
Structure |
|