Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
---|
Ligand | BDBM61210 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) |
---|
IC50 | 67047±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
---|
Name: | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
Synonyms: | PP-1A | PP1A_HUMAN | PPP1A | PPP1CA | Serine/threonine protein phosphatase PP1-alpha catalytic subunit | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | protein phosphatase 1, catalytic subunit, alpha isoform 3 |
Type: | PROTEIN |
Mol. Mass.: | 37510.66 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_197827 |
Residue: | 330 |
Sequence: | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
|
|
|
BDBM61210 |
---|
n/a |
---|
Name | BDBM61210 |
Synonyms: | 3-Acetyl-3a,8b-dihydroxy-2-methyl-3a,8b-dihydro-indeno[1,2-b]furan-4-one | 3-acetyl-3a,8b-dihydroxy-2-methyl-4-indeno[1,2-b]furanone | 3-acetyl-3a,8b-dihydroxy-2-methyl-indeno[1,2-b]furan-4-one | 3-acetyl-3a,8b-dihydroxy-2-methylindeno[1,2-b]furan-4-one | 3-ethanoyl-2-methyl-3a,8b-bis(oxidanyl)indeno[1,2-b]furan-4-one | MLS000768249 | SMR000431570 | cid_2828331 |
Type | Small organic molecule |
Emp. Form. | C14H12O5 |
Mol. Mass. | 260.2421 |
SMILES | CC(=O)C1=C(C)OC2(O)c3ccccc3C(=O)C12O |c:3| |
Structure |
|