| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|
| Ligand | BDBM64802 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) |
|---|
| IC50 | 67047±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of PP5: fluorescence-based biochemical high throughput dose response assay for inhibitors of Protein Phosphatase 1 (PP1) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|
| Name: | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|
| Synonyms: | PP-1A | PP1A_HUMAN | PPP1A | PPP1CA | Serine/threonine protein phosphatase PP1-alpha catalytic subunit | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | protein phosphatase 1, catalytic subunit, alpha isoform 3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37510.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_197827 |
|---|
| Residue: | 330 |
|---|
| Sequence: | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
|
|
|
|---|
| BDBM64802 |
|---|
| n/a |
|---|
| Name | BDBM64802 |
|---|
| Synonyms: | (6,7-dimethoxy-1-isoquinolinyl)-(3,4-dimethoxyphenyl)methanone | (6,7-dimethoxy-1-isoquinolyl)-(3,4-dimethoxyphenyl)methanone | (6,7-dimethoxyisoquinolin-1-yl)-(3,4-dimethoxyphenyl)methanone | MLS001360484 | SMR001223913 | cid_96932 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19NO5 |
|---|
| Mol. Mass. | 353.3686 |
|---|
| SMILES | COc1ccc(cc1OC)C(=O)c1nccc2cc(OC)c(OC)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
