| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trans-activator protein BZLF1 |
|---|
| Ligand | BDBM64842 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) |
|---|
| IC50 | 57589±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Trans-activator protein BZLF1 |
|---|
| Name: | Trans-activator protein BZLF1 |
|---|
| Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 26856.37 |
|---|
| Organism: | Human herpesvirus 4 |
|---|
| Description: | gi_82503229 |
|---|
| Residue: | 245 |
|---|
| Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
|---|
| BDBM64842 |
|---|
| n/a |
|---|
| Name | BDBM64842 |
|---|
| Synonyms: | 1-[4-(2-pyridin-2-ylpyrimidin-4-yl)phenyl]benzimidazole | 1-[4-[2-(2-pyridinyl)-4-pyrimidinyl]phenyl]benzimidazole | 1-[4-[2-(2-pyridyl)pyrimidin-4-yl]phenyl]benzimidazole | 1-{4-[2-(2-pyridinyl)-4-pyrimidinyl]phenyl}-1H-1,3-benzimidazole | MLS000541326 | SMR000126184 | cid_1477836 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H15N5 |
|---|
| Mol. Mass. | 349.388 |
|---|
| SMILES | c1nc2ccccc2n1-c1ccc(cc1)-c1ccnc(n1)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
