Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Trans-activator protein BZLF1 |
---|
Ligand | BDBM34699 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) |
---|
IC50 | 29479±n/a nM |
---|
Citation | PubChem, PC Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Trans-activator protein BZLF1 |
---|
Name: | Trans-activator protein BZLF1 |
Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 26856.37 |
Organism: | Human herpesvirus 4 |
Description: | gi_82503229 |
Residue: | 245 |
Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
BDBM34699 |
---|
n/a |
---|
Name | BDBM34699 |
Synonyms: | 3-(1-adamantyl)-5,6-bis(azanyl)-2-oxidanylidene-8-(3-oxidanylpiperidin-1-yl)-1H-pyrrolo[2,3-c][2,7]naphthyridine-9-carbonitrile | 3-(1-adamantyl)-5,6-diamino-8-(3-hydroxy-1-piperidinyl)-2-oxo-1H-pyrrolo[2,3-c][2,7]naphthyridine-9-carbonitrile | 3-(1-adamantyl)-5,6-diamino-8-(3-hydroxypiperidin-1-yl)-2-oxo-1H-pyrrolo[2,3-c][2,7]naphthyridine-9-carbonitrile | 3-(1-adamantyl)-5,6-diamino-8-(3-hydroxypiperidino)-2-keto-1H-pyrrolo[2,3-c][2,7]naphthyridine-9-carbonitrile | MLS000536166 | SMR000155469 | cid_3962922 |
Type | Small organic molecule |
Emp. Form. | C26H31N7O2 |
Mol. Mass. | 473.57 |
SMILES | [H]C12CC3([H])CC([H])(C1)CC(C2)(C3)N1C(=O)Cc2c1nc(N)c1c(N)nc(N3CCCC(O)C3)c(C#N)c21 |TLB:5:3:11:6.9.8,THB:2:3:9:1.11.8,2:1:9:3.12.5| |
Structure |
|