| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trans-activator protein BZLF1 |
|---|
| Ligand | BDBM64848 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) |
|---|
| IC50 | 37949±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Trans-activator protein BZLF1 |
|---|
| Name: | Trans-activator protein BZLF1 |
|---|
| Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 26856.37 |
|---|
| Organism: | Human herpesvirus 4 |
|---|
| Description: | gi_82503229 |
|---|
| Residue: | 245 |
|---|
| Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
|---|
| BDBM64848 |
|---|
| n/a |
|---|
| Name | BDBM64848 |
|---|
| Synonyms: | 1,3-benzodioxol-5-yl-[7-methyl-2-(2-pyridyl)imidazo[1,2-a]pyridin-3-yl]amine | MLS000580787 | N-(1,3-benzodioxol-5-yl)-7-methyl-2-(2-pyridinyl)-3-imidazo[1,2-a]pyridinamine | N-(1,3-benzodioxol-5-yl)-7-methyl-2-pyridin-2-yl-imidazo[1,2-a]pyridin-3-amine | N-(1,3-benzodioxol-5-yl)-7-methyl-2-pyridin-2-ylimidazo[1,2-a]pyridin-3-amine | N-1,3-benzodioxol-5-yl-7-methyl-2-pyridin-2-ylimidazo[1,2-a]pyridin-3-amine | SMR000206173 | cid_12004827 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H16N4O2 |
|---|
| Mol. Mass. | 344.3666 |
|---|
| SMILES | Cc1ccn2c(Nc3ccc4OCOc4c3)c(nc2c1)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
