| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trans-activator protein BZLF1 |
|---|
| Ligand | BDBM64859 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) |
|---|
| IC50 | 62230±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Trans-activator protein BZLF1 |
|---|
| Name: | Trans-activator protein BZLF1 |
|---|
| Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 26856.37 |
|---|
| Organism: | Human herpesvirus 4 |
|---|
| Description: | gi_82503229 |
|---|
| Residue: | 245 |
|---|
| Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
|---|
| BDBM64859 |
|---|
| n/a |
|---|
| Name | BDBM64859 |
|---|
| Synonyms: | 5-[(2-chloranyl-6-fluoranyl-phenyl)methyl]-2-pyridin-2-yl-pyrimidine-4,6-diamine | 5-[(2-chloro-6-fluorophenyl)methyl]-2-(2-pyridinyl)pyrimidine-4,6-diamine | 5-[(2-chloro-6-fluorophenyl)methyl]-2-pyridin-2-ylpyrimidine-4,6-diamine | 6-amino-5-(2-chloro-6-fluorobenzyl)-2-(2-pyridinyl)-4-pyrimidinylamine | MLS000691909 | SMR000333932 | [6-amino-5-(2-chloro-6-fluoro-benzyl)-2-(2-pyridyl)pyrimidin-4-yl]amine | cid_4667754 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13ClFN5 |
|---|
| Mol. Mass. | 329.759 |
|---|
| SMILES | Nc1nc(nc(N)c1Cc1c(F)cccc1Cl)-c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
