| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trans-activator protein BZLF1 |
|---|
| Ligand | BDBM64030 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) |
|---|
| IC50 | >827.75±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Trans-activator protein BZLF1 |
|---|
| Name: | Trans-activator protein BZLF1 |
|---|
| Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 26856.37 |
|---|
| Organism: | Human herpesvirus 4 |
|---|
| Description: | gi_82503229 |
|---|
| Residue: | 245 |
|---|
| Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
|---|
| BDBM64030 |
|---|
| n/a |
|---|
| Name | BDBM64030 |
|---|
| Synonyms: | 3-Amino-6,6-dimethyl-2-phenyl-2,8-dihydro-6H-pyrano[3,4-c]pyridazine-4-carbonitrile | 3-amino-6,6-dimethyl-2-phenyl-8H-pyrano[3,4-c]pyridazine-4-carbonitrile | 3-azanyl-6,6-dimethyl-2-phenyl-8H-pyrano[3,4-c]pyridazine-4-carbonitrile | MLS001205950 | SMR000513314 | cid_738951 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H16N4O |
|---|
| Mol. Mass. | 280.3244 |
|---|
| SMILES | CC1(C)Cc2c(CO1)nn(-c1ccccc1)c(=N)c2C#N |
|---|
| Structure | 
|
|---|
Search and Browse
