| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trans-activator protein BZLF1 |
|---|
| Ligand | BDBM59569 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) |
|---|
| IC50 | >67047±n/a nM |
|---|
| Citation |  PubChem, PC Counterscreen for inhibitors of PP1: fluorescence-based biochemical high throughput dose response assay to identify inhibitors of Protein Phosphatase 5 (PP5) PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Trans-activator protein BZLF1 |
|---|
| Name: | Trans-activator protein BZLF1 |
|---|
| Synonyms: | BZLF1 | BZLF1_EBVB9 | PPP5C protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 26856.37 |
|---|
| Organism: | Human herpesvirus 4 |
|---|
| Description: | gi_82503229 |
|---|
| Residue: | 245 |
|---|
| Sequence: | MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQ
LTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQNQQTNQAGGEAPQPGDNS
TVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTRKPQQPESLEECDSELEIKRY
KNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHE
DLLNF
|
|
|
|---|
| BDBM59569 |
|---|
| n/a |
|---|
| Name | BDBM59569 |
|---|
| Synonyms: | 2-[3-[2-furanyl(oxo)methyl]-4-hydroxy-2-(3-nitrophenyl)-5-oxo-2H-pyrrol-1-yl]-4-methyl-5-thiazolecarboxylic acid ethyl ester | 2-[4-(2-furoyl)-3-hydroxy-2-keto-5-(3-nitrophenyl)-3-pyrrolin-1-yl]-4-methyl-thiazole-5-carboxylic acid ethyl ester | MLS001082998 | SMR000664801 | cid_2909351 | ethyl 2-[3-(furan-2-carbonyl)-4-hydroxy-2-(3-nitrophenyl)-5-oxo-2H-pyrrol-1-yl]-4-methyl-1,3-thiazole-5-carboxylate | ethyl 2-[3-(furan-2-ylcarbonyl)-2-(3-nitrophenyl)-4-oxidanyl-5-oxidanylidene-2H-pyrrol-1-yl]-4-methyl-1,3-thiazole-5-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H17N3O8S |
|---|
| Mol. Mass. | 483.451 |
|---|
| SMILES | CCOC(=O)c1sc(nc1C)N1C(C(C(=O)c2ccco2)C(=O)C1=O)c1cccc(c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
