Reaction Details |
| Report a problem with these data |
Target | Beta-lactamase |
---|
Ligand | BDBM66109 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Epi-absorbance-based dose response assay for common IMP-1 and VIM-2 inhibitors: biochemical high throughput screening assay to identify inhibitors of VIM-2 metallo-beta-lactamase |
---|
IC50 | 13428±n/a nM |
---|
Citation | PubChem, PC Epi-absorbance-based dose response assay for common IMP-1 and VIM-2 inhibitors: biochemical high throughput screening assay to identify inhibitors of VIM-2 metallo-beta-lactamase PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Beta-lactamase |
---|
Name: | Beta-lactamase |
Synonyms: | Beta lactamase |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 31513.38 |
Organism: | Pseudomonas aeruginosa |
Description: | gi_114881106 |
Residue: | 286 |
Sequence: | MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
|
|
|
BDBM66109 |
---|
n/a |
---|
Name | BDBM66109 |
Synonyms: | 2-(3-Furan-2-yl-4-methyl-pentyl)-isoindole-1,3-dione | 2-[3-(2-furanyl)-4-methylpentyl]isoindole-1,3-dione | 2-[3-(2-furyl)-4-methyl-pentyl]isoindoline-1,3-quinone | 2-[3-(furan-2-yl)-4-methyl-pentyl]isoindole-1,3-dione | 2-[3-(furan-2-yl)-4-methylpentyl]isoindole-1,3-dione | MLS000557321 | SMR000148238 | cid_4418419 |
Type | Small organic molecule |
Emp. Form. | C18H19NO3 |
Mol. Mass. | 297.3484 |
SMILES | CC(C)C(CCN1C(=O)c2ccccc2C1=O)c1ccco1 |
Structure |
|