| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase |
|---|
| Ligand | BDBM66136 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Epi-absorbance-based dose response assay for common IMP-1 and VIM-2 inhibitors: biochemical high throughput counterscreen to identify inhibitors of TEM-1 metallo-beta-lactamase |
|---|
| IC50 | 3411±n/a nM |
|---|
| Citation |  PubChem, PC Epi-absorbance-based dose response assay for common IMP-1 and VIM-2 inhibitors: biochemical high throughput counterscreen to identify inhibitors of TEM-1 metallo-beta-lactamase PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Beta-lactamase |
|---|
| Name: | Beta-lactamase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 29494.42 |
|---|
| Organism: | Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 |
|---|
| Description: | gi_60115532 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTDGESGNYG
|
|
|
|---|
| BDBM66136 |
|---|
| n/a |
|---|
| Name | BDBM66136 |
|---|
| Synonyms: | 2-amino-5-(3-hydroxy-6-keto-xanthen-9-yl)benzoic acid | 2-amino-5-(3-hydroxy-6-oxo-9-xanthenyl)benzoic acid | 2-amino-5-(3-hydroxy-6-oxoxanthen-9-yl)benzoic acid | 2-azanyl-5-(3-oxidanyl-6-oxidanylidene-xanthen-9-yl)benzoic acid | MLS001216583 | SMR000544115 | cid_3801816 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H13NO5 |
|---|
| Mol. Mass. | 347.3209 |
|---|
| SMILES | Nc1ccc(cc1C(O)=O)-c1c2ccc(O)cc2oc2cc(=O)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
