| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase |
|---|
| Ligand | BDBM41501 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Epi-absorbance-based dose response assay for common IMP-1 and VIM-2 inhibitors: biochemical high throughput screening assay to identify inhibitors of IMP-1metallo-beta-lactamase |
|---|
| IC50 | 11484±n/a nM |
|---|
| Citation |  PubChem, PC Epi-absorbance-based dose response assay for common IMP-1 and VIM-2 inhibitors: biochemical high throughput screening assay to identify inhibitors of IMP-1metallo-beta-lactamase PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Beta-lactamase |
|---|
| Name: | Beta-lactamase |
|---|
| Synonyms: | Beta-lactamase | metallo-beta-lactamase IMP-1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 27125.88 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | gi_27368096 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA
EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT
NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
PSKPSN
|
|
|
|---|
| BDBM41501 |
|---|
| n/a |
|---|
| Name | BDBM41501 |
|---|
| Synonyms: | 3-Methyl-1-phenethylamino-3H-naphtho[1,2,3-de]quinoline-2,7-dione | MLS000550973 | SMR000145101 | cid_1262928 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H20N2O2 |
|---|
| Mol. Mass. | 380.4385 |
|---|
| SMILES | Cn1c2cccc3C(=O)c4ccccc4-c(c(NCCc4ccccc4)c1=O)c23 |
|---|
| Structure | 
|
|---|
Search and Browse
