| Reaction Details |
|---|
 | Report a problem with these data |
| Target | DNA damage-inducible transcript 3 protein |
|---|
| Ligand | BDBM68024 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress |
|---|
| IC50 | 450±n/a nM |
|---|
| Citation |  PubChem, PC Dose-response primary assay and counterscreen assay for HTS small molecule inhibitors of CHOP to regulate the unfolded protein response to ER stress PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| DNA damage-inducible transcript 3 protein |
|---|
| Name: | DNA damage-inducible transcript 3 protein |
|---|
| Synonyms: | Chop | Chop10 | DDIT3_MOUSE | Ddit3 | Gadd153 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19175.17 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | gi_160707929 |
|---|
| Residue: | 168 |
|---|
| Sequence: | MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASL
AWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA
|
|
|
|---|
| BDBM68024 |
|---|
| n/a |
|---|
| Name | BDBM68024 |
|---|
| Synonyms: | 2-[2-[(3,4-dimethoxyphenyl)methyl]-1-benzimidazolyl]-N'-[(E)-(4-methyl-6-oxo-1-cyclohexa-2,4-dienylidene)methyl]acetohydrazide | 2-[2-[(3,4-dimethoxyphenyl)methyl]benzimidazol-1-yl]-N'-[(E)-(4-methyl-6-oxidanylidene-cyclohexa-2,4-dien-1-ylidene)methyl]ethanehydrazide | 2-[2-[(3,4-dimethoxyphenyl)methyl]benzimidazol-1-yl]-N'-[(E)-(4-methyl-6-oxocyclohexa-2,4-dien-1-ylidene)methyl]acetohydrazide | MLS000587847 | N'-[(E)-(6-keto-4-methyl-cyclohexa-2,4-dien-1-ylidene)methyl]-2-(2-veratrylbenzimidazol-1-yl)acetohydrazide | SMR000211867 | [2-(3,4-Dimethoxy-benzyl)-benzoimidazol-1-yl]-acetic acid [1-(2-hydroxy-4-methyl-phenyl)-meth-(E)-ylidene]-hydrazide | cid_5936719 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26N4O4 |
|---|
| Mol. Mass. | 458.509 |
|---|
| SMILES | COc1ccc(Cc2nc3ccccc3n2CC(=O)NN=Cc2ccc(C)cc2O)cc1OC |w:20.21| |
|---|
| Structure | 
|
|---|
Search and Browse
