Reaction Details |
| Report a problem with these data |
Target | Melanin-concentrating hormone receptor 1 |
---|
Ligand | BDBM75933 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7) |
---|
IC50 | 3300±n/a nM |
---|
Citation | PubChem, PC Late-stage fluorescence-based counterscreen for antagonists of the G-protein coupled receptor 7 (GPR7): cell-based dose response assay to identify antagonists of the melanin-concentrating hormone receptor 1 (MCHR1) PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Melanin-concentrating hormone receptor 1 |
---|
Name: | Melanin-concentrating hormone receptor 1 |
Synonyms: | G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | MCHR1 | MCHR1_HUMAN | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | SLC1 | Somatostatin receptor-like protein |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 45976.27 |
Organism: | Homo sapiens (Human) |
Description: | Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays. |
Residue: | 422 |
Sequence: | MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
|
|
|
BDBM75933 |
---|
n/a |
---|
Name | BDBM75933 |
Synonyms: | SR-02000000469 | SR-02000000469-1 | [1-(2,3-dichlorobenzyl)-2-piperidyl]-[4-(4-nitrophenyl)piperazino]methanone | [1-[(2,3-dichlorophenyl)methyl]-2-piperidinyl]-[4-(4-nitrophenyl)-1-piperazinyl]methanone | [1-[(2,3-dichlorophenyl)methyl]piperidin-2-yl]-[4-(4-nitrophenyl)piperazin-1-yl]methanone | [1-[[2,3-bis(chloranyl)phenyl]methyl]piperidin-2-yl]-[4-(4-nitrophenyl)piperazin-1-yl]methanone | cid_46846316 |
Type | Small organic molecule |
Emp. Form. | C23H26Cl2N4O3 |
Mol. Mass. | 477.384 |
SMILES | [O-][N+](=O)c1ccc(cc1)N1CCN(CC1)C(=O)C1CCCCN1Cc1cccc(Cl)c1Cl |
Structure |
|