| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM45519 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SAR analysis of antagonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 3 |
|---|
| IC50 | >32000±n/a nM |
|---|
| Citation |  PubChem, PC SAR analysis of antagonists of the Cannabinoid Receptor 2 using an Image-Based Assay - Set 3 PubChem Bioassay(2010)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM45519 |
|---|
| n/a |
|---|
| Name | BDBM45519 |
|---|
| Synonyms: | 2-(2,4-dimethylphenyl)-N-(4-{[(5-methyl-3-isoxazolyl)amino]sulfonyl}phenyl)-4-quinolinecarboxamide | 2-(2,4-dimethylphenyl)-N-[4-[(5-methyl-1,2-oxazol-3-yl)sulfamoyl]phenyl]quinoline-4-carboxamide | 2-(2,4-dimethylphenyl)-N-[4-[(5-methyl-3-isoxazolyl)sulfamoyl]phenyl]-4-quinolinecarboxamide | 2-(2,4-dimethylphenyl)-N-[4-[(5-methylisoxazol-3-yl)sulfamoyl]phenyl]cinchoninamide | MLS000540783 | SMR000162174 | cid_1011349 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H24N4O4S |
|---|
| Mol. Mass. | 512.58 |
|---|
| SMILES | Cc1cc(NS(=O)(=O)c2ccc(NC(=O)c3cc(nc4ccccc34)-c3ccc(C)cc3C)cc2)no1 |
|---|
| Structure | 
|
|---|
Search and Browse
