Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Mitochondrial import inner membrane translocase subunit TIM10 |
---|
Ligand | BDBM78151 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of uHTS small molecule inhibitors of tim10-1 yeast via a luminescent assay |
---|
IC50 | 3340±n/a nM |
---|
Citation | PubChem, PC Dose Response confirmation of uHTS small molecule inhibitors of tim10-1 yeast via a luminescent assay PubChem Bioassay(2010)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Mitochondrial import inner membrane translocase subunit TIM10 |
---|
Name: | Mitochondrial import inner membrane translocase subunit TIM10 |
Synonyms: | MRS11 | TIM10 | TIM10_YEAST | TPA: Essential protein of the mitochondrial intermembrane space | TPA: Essential protein of the mitochondrial intermembrane space, forms a complex with Tim9p (TIM10 complex) that delivers hydrophobic proteins to the TIM22 complex for insertion into the inner ... |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 10303.50 |
Organism: | Saccharomyces cerevisiae S288c |
Description: | gi_285809906 |
Residue: | 93 |
Sequence: | MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS
CLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF
|
|
|
BDBM78151 |
---|
n/a |
---|
Name | BDBM78151 |
Synonyms: | 4-chloro-N'-[(4-chlorobenzoyl)oxy]benzenecarboximidamide | 4-chlorobenzoic acid [(Z)-[amino-(4-chlorophenyl)methylene]amino] ester | 4-chlorobenzoic acid [(Z)-[amino-(4-chlorophenyl)methylidene]amino] ester | MLS000578025 | SMR000187210 | [(Z)-[amino-(4-chlorophenyl)methylidene]amino] 4-chlorobenzoate | [(Z)-[azanyl-(4-chlorophenyl)methylidene]amino] 4-chloranylbenzoate | cid_9567277 |
Type | Small organic molecule |
Emp. Form. | C14H10Cl2N2O2 |
Mol. Mass. | 309.147 |
SMILES | NC(=NOC(=O)c1ccc(Cl)cc1)c1ccc(Cl)cc1 |w:2.2| |
Structure |
|