Reaction Details |
| Report a problem with these data |
Target | Ubiquitin-conjugating enzyme E2 N |
---|
Ligand | BDBM67694 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay reconfirm |
---|
IC50 | 2281±80 nM |
---|
Citation | PubChem, PC Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay reconfirm PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Ubiquitin-conjugating enzyme E2 N |
---|
Name: | Ubiquitin-conjugating enzyme E2 N |
Synonyms: | BLU | UBE2N | UBE2N_HUMAN | ubiquitin-conjugating enzyme E2 N |
Type: | PROTEIN |
Mol. Mass.: | 17137.61 |
Organism: | Homo sapiens (Human) |
Description: | EBI_101440 |
Residue: | 152 |
Sequence: | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
|
|
|
BDBM67694 |
---|
n/a |
---|
Name | BDBM67694 |
Synonyms: | MLS002232301 | N'-[4-[[5-[3-[[(E)-4-(dimethylamino)-1-oxobut-2-enyl]amino]phenyl]-7H-pyrrolo[2,3-d]pyrimidin-4-yl]oxy]-3-fluorophenyl]-N-(4-fluorophenyl)propanediamide | N'-[4-[[5-[3-[[(E)-4-(dimethylamino)but-2-enoyl]amino]phenyl]-7H-pyrrolo[2,3-d]pyrimidin-4-yl]oxy]-3-fluoranyl-phenyl]-N-(4-fluorophenyl)propanediamide | N'-[4-[[5-[3-[[(E)-4-(dimethylamino)but-2-enoyl]amino]phenyl]-7H-pyrrolo[2,3-d]pyrimidin-4-yl]oxy]-3-fluoro-phenyl]-N-(4-fluorophenyl)malonamide | N'-[4-[[5-[3-[[(E)-4-(dimethylamino)but-2-enoyl]amino]phenyl]-7H-pyrrolo[2,3-d]pyrimidin-4-yl]oxy]-3-fluorophenyl]-N-(4-fluorophenyl)propanediamide | SMR001307855 | cid_42601361 |
Type | Small organic molecule |
Emp. Form. | C33H29F2N7O4 |
Mol. Mass. | 625.6247 |
SMILES | CN(C)C\C=C\C(=O)Nc1cccc(c1)-c1c[nH]c2ncnc(Oc3ccc(NC(=O)CC(=O)Nc4ccc(F)cc4)cc3F)c12 |
Structure |
|