Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bcl-2-related protein A1 |
---|
Ligand | BDBM29615 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of UBC13 Polyubiquitin Inhibitors using a Bfl-1 counterscreen |
---|
IC50 | 1100±24 nM |
---|
Citation | PubChem, PC Dose Response confirmation of UBC13 Polyubiquitin Inhibitors using a Bfl-1 counterscreen PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Bcl-2-related protein A1 |
---|
Name: | Bcl-2-related protein A1 |
Synonyms: | A1 | A1-A | B-cell leukemia/lymphoma 2 related protein A1a | B2LA1_MOUSE | Bcl2a1 | Bcl2a1a | Bfl-1 | Bfl1 | Hemopoietic-specific early response protein | Protein BFL-1 |
Type: | Apoptosis regulator protein |
Mol. Mass.: | 19909.74 |
Organism: | Mus musculus (Mouse) |
Description: | gi_11024684 |
Residue: | 172 |
Sequence: | MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSS
FVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK
|
|
|
BDBM29615 |
---|
n/a |
---|
Name | BDBM29615 |
Synonyms: | 6-methoxy-3a,4,5,9b-tetrahydro-3H-cyclopenta[c]quinoline-4-carboxylic acid | MLS000072167 | SMR000009698 | US11584714, Compound 15 | cid_652912 |
Type | Small organic molecule |
Emp. Form. | C14H15NO3 |
Mol. Mass. | 245.2738 |
SMILES | COc1cccc2C3C=CCC3C(Nc12)C(O)=O |c:8| |
Structure |
|