Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | DNA dC->dU-editing enzyme APOBEC-3A |
---|
Ligand | BDBM80106 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of APOBEC3G DNA Deaminase Inhibitors via a A3A counterscreen |
---|
Temperature | 298.15±n/a K |
---|
IC50 | >100000±n/a nM |
---|
Comments | extracted |
---|
Citation | PubChem, PC Dose Response confirmation of APOBEC3G DNA Deaminase Inhibitors via a A3A counterscreen PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
DNA dC->dU-editing enzyme APOBEC-3A |
---|
Name: | DNA dC->dU-editing enzyme APOBEC-3A |
Synonyms: | ABC3A_HUMAN | APOBEC3A | probable DNA dC->dU-editing enzyme APOBEC-3A |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 23013.77 |
Organism: | Homo sapiens (Human) |
Description: | gi_21955158 |
Residue: | 199 |
Sequence: | MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHV
RLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLD
EHSQALSGRLRAILQNQGN
|
|
|
BDBM80106 |
---|
n/a |
---|
Name | BDBM80106 |
Synonyms: | 3-methoxy-N-[[4-(3-methylphenyl)-5-sulfanylidene-1H-1,2,4-triazol-3-yl]methyl]benzamide | 3-methoxy-N-[[4-(m-tolyl)-5-thioxo-1H-1,2,4-triazol-3-yl]methyl]benzamide | 3-methoxy-N-{[4-(3-methylphenyl)-5-thioxo-4,5-dihydro-1H-1,2,4-triazol-3-yl]methyl}benzamide | MLS000088524 | SMR000024144 | cid_3240676 |
Type | Small organic molecule |
Emp. Form. | C18H18N4O2S |
Mol. Mass. | 354.426 |
SMILES | COc1cccc(c1)C(=O)NCc1n[nH]c(=S)n1-c1cccc(C)c1 |
Structure |
|