| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phosducin-like protein 3 |
|---|
| Ligand | BDBM81741 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | NMR Screening Assay |
|---|
| pH | 7.5±0 |
|---|
| Temperature | 300.15±0 K |
|---|
| Kd | 7.6e+4±n/a nM |
|---|
| Citation |  Bisson, WH; Zhang, Z; Welsh, K; Huang, JW; Ryan, J; Reed, JC; Pellecchia, M Binding properties of the C-terminal domain of VIAF. Chem Biol Drug Des72:331-6 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Phosducin-like protein 3 |
|---|
| Name: | Phosducin-like protein 3 |
|---|
| Synonyms: | PDCL3 | PDCL3_HUMAN | PhLP2A | Phosducin-like protein 3 | VIAF1 | Viral IAP-associated factor 1 (VIAF) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27599.44 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9H2J4 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHE
DEFNEEDERAIEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLY
KQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIG
PLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD
|
|
|
|---|
| BDBM81741 |
|---|
| n/a |
|---|
| Name | BDBM81741 |
|---|
| Synonyms: | BI-86-E12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H18N2O3S |
|---|
| Mol. Mass. | 306.38 |
|---|
| SMILES | CCOC(=O)C(C)n1cnc2sc3CCCCc3c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
