| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2B |
|---|
| Ligand | BDBM21342 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 11±n/a nM |
|---|
| Comments | PDSP_1091 |
|---|
| Citation |  McKenna, DJ; Peroutka, SJ Differentiation of 5-hydroxytryptamine2 receptor subtypes using 125I-R-(-)2,5-dimethoxy-4-iodo-phenylisopropylamine and 3H-ketanserin. J Neurosci9:3482-90 (1989) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 2B |
|---|
| Name: | 5-hydroxytryptamine receptor 2B |
|---|
| Synonyms: | 5-HT2B | 5-hydroxytryptamine 2B receptor | HTR2B |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15564.62 |
|---|
| Organism: | BOVINE |
|---|
| Description: | Q8MI09 |
|---|
| Residue: | 137 |
|---|
| Sequence: | KPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGFHKDKTLPNASADILMRRMSTVGKKSV
QTISNEQRASKVLGIVFFLFLLMWCPFFITNVTLVLCDSCNQTTLNMLLEIFVWIGYVSS
GVNPLVYTLFNKTFRDA
|
|
|
|---|
| BDBM21342 |
|---|
| n/a |
|---|
| Name | BDBM21342 |
|---|
| Synonyms: | (4R,7R)-N,N-diethyl-6-methyl-6,11-diazatetracyclo[7.6.1.0^{2,7}.0^{12,16}]hexadeca-1(16),2,9,12,14-pentaene-4-carboxamide | CHEMBL263881 | LSD | LSD 25 | LSD,(+) | LSD,l- | Lysergic Acid Diethylamide | Lysergic Acid Diethylamide Tartrate | [3H]-LSD | d-Isolysergic acid amide |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C20H25N3O |
|---|
| Mol. Mass. | 323.432 |
|---|
| SMILES | [H][C@@]12Cc3c[nH]c4cccc(C1=C[C@H](CN2C)C(=O)N(CC)CC)c34 |c:12| |
|---|
| Structure | 
|
|---|
Search and Browse
