| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cholecystokinin |
|---|
| Ligand | BDBM82386 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1100±n/a nM |
|---|
| Comments | PDSP_16 |
|---|
| Citation |  Evans, BE; Bock, MG; Rittle, KE; DiPardo, RM; Whitter, WL; Veber, DF; Anderson, PS; Freidinger, RM Design of potent, orally effective, nonpeptidal antagonists of the peptide hormone cholecystokinin. Proc Natl Acad Sci U S A83:4918-22 (1986) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Cholecystokinin |
|---|
| Name: | Cholecystokinin |
|---|
| Synonyms: | CCKN_RAT | Cck |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12844.29 |
|---|
| Organism: | RAT |
|---|
| Description: | Cholecystokinin 0 RAT::P01355 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
|
|
|
|---|
| BDBM82386 |
|---|
| n/a |
|---|
| Name | BDBM82386 |
|---|
| Synonyms: | CCK antagonist synthetic 15 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C25H19FN4O2 |
|---|
| Mol. Mass. | 426.4424 |
|---|
| SMILES | Cc1ccc2c(c[nH]c2c1)C(=O)NC1N=C(c2ccccc2F)c2ccccc2NC1=O |t:16| |
|---|
| Structure | 
|
|---|
Search and Browse
