| Reaction Details |
|---|
 | Report a problem with these data |
| Target | GABA(A) receptor-associated protein |
|---|
| Ligand | BDBM82393 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_210 |
|---|
| Citation |  Evans, BE; Bock, MG; Rittle, KE; DiPardo, RM; Whitter, WL; Veber, DF; Anderson, PS; Freidinger, RM Design of potent, orally effective, nonpeptidal antagonists of the peptide hormone cholecystokinin. Proc Natl Acad Sci U S A83:4918-22 (1986) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| GABA(A) receptor-associated protein |
|---|
| Name: | GABA(A) receptor-associated protein |
|---|
| Synonyms: | GABA A Benzodiazepine | GABA-A receptor subunit alpha 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13921.89 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | D7RA28 |
|---|
| Residue: | 117 |
|---|
| Sequence: | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
|
|
|
|---|
| BDBM82393 |
|---|
| n/a |
|---|
| Name | BDBM82393 |
|---|
| Synonyms: | CCK antagonist synthetic 9 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C24H18FN3O |
|---|
| Mol. Mass. | 383.4176 |
|---|
| SMILES | Fc1ccccc1C1=N[C@H](Cc2c[nH]c3ccccc23)C(=O)Nc2ccccc12 |t:8| |
|---|
| Structure | 
|
|---|
Search and Browse
