| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2 |
|---|
| Ligand | BDBM80913 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose response counterscreen of uHTS hits for ATG4B inhibitors in a Phospholipase A2 assay |
|---|
| IC50 | 321±n/a nM |
|---|
| Citation |  PubChem, PC Dose response counterscreen of uHTS hits for ATG4B inhibitors in a Phospholipase A2 assay PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2 |
|---|
| Name: | Phospholipase A2 |
|---|
| Synonyms: | Group IB phospholipase A2 | PA21B_HUMAN | PLA2 | PLA2A | PLA2G1B | PPLA2 | Phosphatidylcholine 2-acylhydrolase 1B | Phospholipase A2 (PLA2) | Phospholipase A2 group 1B | phospholipase A2 precursor |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 16364.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P04054 |
|---|
| Residue: | 148 |
|---|
| Sequence: | MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPV
DELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNC
DRNAAICFSKAPYNKAHKNLDTKKYCQS
|
|
|
|---|
| BDBM80913 |
|---|
| n/a |
|---|
| Name | BDBM80913 |
|---|
| Synonyms: | 2-[(5-acetyl-2-methoxy-benzyl)thio]-3-(m-tolyl)quinazolin-4-one | 2-[(5-acetyl-2-methoxyphenyl)methylsulfanyl]-3-(3-methylphenyl)quinazolin-4-one | 2-[(5-acetyl-2-methoxyphenyl)methylthio]-3-(3-methylphenyl)-4-quinazolinone | 2-[(5-ethanoyl-2-methoxy-phenyl)methylsulfanyl]-3-(3-methylphenyl)quinazolin-4-one | MLS000389320 | SMR000255593 | cid_2537078 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22N2O3S |
|---|
| Mol. Mass. | 430.519 |
|---|
| SMILES | COc1ccc(cc1CSc1nc2ccccc2c(=O)n1-c1cccc(C)c1)C(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
