Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Galectin-1 |
---|
Ligand | BDBM50247485 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1677820 (CHEMBL4027963) |
---|
Kd | 170000±n/a nM |
---|
Citation | Peterson, K; Kumar, R; Stenström, O; Verma, P; Verma, PR; Håkansson, M; Kahl-Knutsson, B; Zetterberg, F; Leffler, H; Akke, M; Logan, DT; Nilsson, UJ Systematic Tuning of Fluoro-galectin-3 Interactions Provides Thiodigalactoside Derivatives with Single-Digit nM Affinity and High Selectivity. J Med Chem61:1164-1175 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Galectin-1 |
---|
Name: | Galectin-1 |
Synonyms: | 14 kDa lectin | Galaptin | HPL | LEG1_HUMAN | LGALS1 | Lactose-binding lectin 1 | Lectin galactoside-binding soluble 1 | Putative MAPK-activating protein PM12 |
Type: | beta galactoside-binding protein |
Mol. Mass.: | 14713.53 |
Organism: | Homo sapiens (Human) |
Description: | P09382 |
Residue: | 135 |
Sequence: | MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
|
|
|
BDBM50247485 |
---|
n/a |
---|
Name | BDBM50247485 |
Synonyms: | CHEMBL4072396 |
Type | Small organic molecule |
Emp. Form. | C22H24FN3O4S |
Mol. Mass. | 445.507 |
SMILES | Cc1ccc(S[C@@H]2O[C@H](CO)[C@H](O)[C@@H]([C@H]2O)n2cc(nn2)-c2ccc(F)c(C)c2)cc1 |r| |
Structure |
|