| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Galectin-3 |
|---|
| Ligand | BDBM50247510 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1677821 (CHEMBL4027964) |
|---|
| Kd | 15000±n/a nM |
|---|
| Citation |  Peterson, K; Kumar, R; Stenström, O; Verma, P; Verma, PR; Håkansson, M; Kahl-Knutsson, B; Zetterberg, F; Leffler, H; Akke, M; Logan, DT; Nilsson, UJ Systematic Tuning of Fluoro-galectin-3 Interactions Provides Thiodigalactoside Derivatives with Single-Digit nM Affinity and High Selectivity. J Med Chem61:1164-1175 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Galectin-3 |
|---|
| Name: | Galectin-3 |
|---|
| Synonyms: | LEG3_HUMAN | LGALS3 | MAC2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26156.54 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P17931 |
|---|
| Residue: | 250 |
|---|
| Sequence: | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYTMI
|
|
|
|---|
| BDBM50247510 |
|---|
| n/a |
|---|
| Name | BDBM50247510 |
|---|
| Synonyms: | CHEMBL4068730 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21F2N3O4S |
|---|
| Mol. Mass. | 449.471 |
|---|
| SMILES | Cc1ccc(S[C@@H]2O[C@H](CO)[C@H](O)[C@@H]([C@H]2O)n2cc(nn2)-c2cc(F)cc(F)c2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
