| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50321767 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1685096 |
|---|
| Ki | 510±n/a nM |
|---|
| Citation |  Knappmann, I; Lehmkuhl, K; Köhler, J; Schepmann, D; Giera, M; Bracher, F; Wünsch, B Lipase-catalyzed kinetic resolution as key step in the synthesis of enantiomerically pure? ligands with 2-benzopyran structure. Bioorg Med Chem25:3384-3395 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50321767 |
|---|
| n/a |
|---|
| Name | BDBM50321767 |
|---|
| Synonyms: | (R)-2-(1'-(cyclohexylmethyl)spiro[isochroman-1,4'-piperidine]-3-yl)ethanol | CHEMBL1171865 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H33NO2 |
|---|
| Mol. Mass. | 343.5029 |
|---|
| SMILES | OCC[C@H]1Cc2ccccc2C2(CCN(CC3CCCCC3)CC2)O1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
