| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50007551 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201907 (CHEMBL808198) |
|---|
| Ki | 550±n/a nM |
|---|
| Citation |  Froimowitz, M; Rämsby, S Conformational properties of semirigid antipsychotic drugs: the pharmacophore for dopamine D-2 antagonist activity. J Med Chem34:1707-14 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50007551 |
|---|
| n/a |
|---|
| Name | BDBM50007551 |
|---|
| Synonyms: | 3'-chlorospiro[2-cyclohexene-1,5'-(10',11'-dihydro-5'H-dibenzo[a,d]cycloheptene)]-4-yl(dimethyl)amine | CHEMBL45491 | Enantiomer 1'3'-chlorospiro[2-cyclohexene-1,5'-(10',11'-dihydro-5'H-dibenzo[a,d]cycloheptene)]-4-yl(dimethyl)amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24ClN |
|---|
| Mol. Mass. | 337.886 |
|---|
| SMILES | CN(C)C1CCC2(C=C1)c1ccccc1CCc1ccc(Cl)cc21 |c:7| |
|---|
| Structure | 
|
|---|
Search and Browse
