Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50260592 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1694032 |
---|
Ki | >1000±n/a nM |
---|
Citation | Fanter, L; Müller, C; Schepmann, D; Bracher, F; Wünsch, B Chiral-pool synthesis of 1,2,4-trisubstituted 1,4-diazepanes as novel? Bioorg Med Chem25:4778-4799 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50260592 |
---|
n/a |
---|
Name | BDBM50260592 |
Synonyms: | CHEMBL4081826 |
Type | Small organic molecule |
Emp. Form. | C23H32N2O |
Mol. Mass. | 352.513 |
SMILES | COc1ccc(CN2CCCN(Cc3ccccc3)[C@H](C2)C(C)C)cc1 |r| |
Structure |
|