| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50030196 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1698009 |
|---|
| Ki | 7.2±n/a nM |
|---|
| Citation |  Del Bello, F; Bonifazi, A; Giorgioni, G; Cifani, C; Micioni Di Bonaventura, MV; Petrelli, R; Piergentili, A; Fontana, S; Mammoli, V; Yano, H; Matucci, R; Vistoli, G; Quaglia, W 1-[3-(4-Butylpiperidin-1-yl)propyl]-1,2,3,4-tetrahydroquinolin-2-one (77-LH-28-1) as a Model for the Rational Design of a Novel Class of Brain Penetrant Ligands with High Affinity and Selectivity for Dopamine D J Med Chem61:3712-3725 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50030196 |
|---|
| n/a |
|---|
| Name | BDBM50030196 |
|---|
| Synonyms: | CHEMBL3354065 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H32N2O |
|---|
| Mol. Mass. | 328.4916 |
|---|
| SMILES | CCCCC1CCN(CCCN2C(=O)CCc3ccccc23)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
