| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Ligand | BDBM50162774 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1701620 (CHEMBL4052853) |
|---|
| Ki | >444±n/a nM |
|---|
| Citation |  Yap, JL; Chen, L; Lanning, ME; Fletcher, S Expanding the Cancer Arsenal with Targeted Therapies: Disarmament of the Antiapoptotic Bcl-2 Proteins by Small Molecules. J Med Chem60:821-838 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
|---|
| Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
|---|
| Type: | Membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 37332.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q07820 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
|---|
| BDBM50162774 |
|---|
| n/a |
|---|
| Name | BDBM50162774 |
|---|
| Synonyms: | ABT-199 | US11420968, Example ABT-199 | Venetoclax |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C45H50ClN7O7S |
|---|
| Mol. Mass. | 868.439 |
|---|
| SMILES | CC1(C)CCC(CN2CCN(CC2)c2ccc(C(=O)NS(=O)(=O)c3ccc(NCC4CCOCC4)c(c3)N(=O)=O)c(Oc3cnc4[nH]ccc4c3)c2)=C(C1)c1ccc(Cl)cc1 |c:57| |
|---|
| Structure | 
|
|---|
Search and Browse
