Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | NAD-dependent protein deacetylase sirtuin-2 |
---|
Ligand | BDBM50156760 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1703196 (CHEMBL4054429) |
---|
IC50 | 47100±n/a nM |
---|
Citation | Schnekenburger, M; Goffin, E; Lee, JY; Jang, JY; Mazumder, A; Ji, S; Rogister, B; Bouider, N; Lefranc, F; Miklos, W; Mathieu, V; de Tullio, P; Kim, KW; Dicato, M; Berger, W; Han, BW; Kiss, R; Pirotte, B; Diederich, M Discovery and Characterization of R/S-N-3-Cyanophenyl-N'-(6-tert-butoxycarbonylamino-3,4-dihydro-2,2-dimethyl-2H-1-benzopyran-4-yl)urea, a New Histone Deacetylase Class III Inhibitor Exerting Antiproliferative Activity against Cancer Cell Lines. J Med Chem60:4714-4733 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
NAD-dependent protein deacetylase sirtuin-2 |
---|
Name: | NAD-dependent protein deacetylase sirtuin-2 |
Synonyms: | NAD-Dependent Deacetylase Sirtuin-2 | NAD-dependent deacetylase sirtuin 2 | NAD-dependent deacetylase sirtuin 3 | NAD-dependent protein deacetylase sirtuin-2 (SIRT2) | SIR2-like | SIR2-like protein 2 | SIR2L | SIR2L2 | SIR2_HUMAN | SIRT2 | Sirtuin 2 (SIRT2) |
Type: | Hydrolase |
Mol. Mass.: | 43172.62 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 389 |
Sequence: | MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
|
|
|
BDBM50156760 |
---|
n/a |
---|
Name | BDBM50156760 |
Synonyms: | (E)-2-((2-hydroxynaphthalen-1-yl)methyleneamino)-N-(1-phenylethyl)benzamide | 2-((2-hydroxynaphthalen-1-yl)methyleneamino)-N-(1-phenylethyl)benzamide | 2-{[(1-(2-hydroxy-naphthalen-1-yl)meth-(E)-ylidene]amino}-N-(1-phenylethyl)-benzamide | 2-{[1-(2-hydroxynaphthalen-1-yl)meth-(E)-ylene]amino}-N-(1-phenylethyl)benzamide | CHEMBL380797 | Sirtinol |
Type | Small organic molecule |
Emp. Form. | C26H22N2O2 |
Mol. Mass. | 394.4651 |
SMILES | CC(NC(=O)c1ccccc1\N=C\c1c(O)ccc2ccccc12)c1ccccc1 |
Structure |
|