| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50270517 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1709400 (CHEMBL4119449) |
|---|
| IC50 | 16±n/a nM |
|---|
| Citation |  Bai, X; Yang, Z; Zhu, M; Dong, B; Zhou, L; Zhang, G; Wang, J; Wang, Y Design and synthesis of potent HIV-1 protease inhibitors with (S)-tetrahydrofuran-tertiary amine-acetamide as P2-ligand: Structure-activity studies and biological evaluation. Eur J Med Chem137:30-44 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50270517 |
|---|
| n/a |
|---|
| Name | BDBM50270517 |
|---|
| Synonyms: | CHEMBL4127148 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H39N3O6S |
|---|
| Mol. Mass. | 533.68 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)N(CC(C)C)C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)CN[C@@H]1CCOC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
