Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM321285 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1716891 |
---|
Ki | 1.2±n/a nM |
---|
Citation | Donnier-Maréchal, M; Carato, P; Larchanché, PE; Ravez, S; Boulahjar, R; Barczyk, A; Oxombre, B; Vermersch, P; Melnyk, P Synthesis and pharmacological evaluation of benzamide derivatives as potent and selective sigma-1 protein ligands. Eur J Med Chem138:964-978 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM321285 |
---|
n/a |
---|
Name | BDBM321285 |
Synonyms: | N-(2-(benzyl(methyl)amino)ethyl)-4-cyanobenzamide | US10179761, Compound 3.1.36 |
Type | Small organic molecule |
Emp. Form. | C18H19N3O |
Mol. Mass. | 293.363 |
SMILES | CN(CCNC(=O)c1ccc(cc1)C#N)Cc1ccccc1 |
Structure |
|