Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50338990 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1722785 (CHEMBL4137785) |
---|
Ki | 62±n/a nM |
---|
Citation | Bautista-Aguilera, ÓM; Budni, J; Mina, F; Medeiros, EB; Deuther-Conrad, W; Entrena, JM; Moraleda, I; Iriepa, I; López-Muñoz, F; Marco-Contelles, J Contilisant, a Tetratarget Small Molecule for Alzheimer's Disease Therapy Combining Cholinesterase, Monoamine Oxidase Inhibition, and H3R Antagonism with S1R Agonism Profile. J Med Chem61:6937-6943 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50338990 |
---|
n/a |
---|
Name | BDBM50338990 |
Synonyms: | 1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine | CHEMBL2311153 | CHEMBL408867 | N-phenylpropyl-N''-3,4-dimethoxyphenethyl piperazine |
Type | Small organic molecule |
Emp. Form. | C23H32N2O2 |
Mol. Mass. | 368.5124 |
SMILES | COc1ccc(CCN2CCN(CCCc3ccccc3)CC2)cc1OC |
Structure |
|