| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein lin-28 homolog A |
|---|
| Ligand | BDBM50345905 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1734969 (CHEMBL4150505) |
|---|
| IC50 | 11700±n/a nM |
|---|
| Citation |  Lorenz, DA; Kaur, T; Kerk, SA; Gallagher, EE; Sandoval, J; Garner, AL Expansion of cat-ELCCA for the Discovery of Small Molecule Inhibitors of the Pre-let-7-Lin28 RNA-Protein Interaction. ACS Med Chem Lett9:517-521 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein lin-28 homolog A |
|---|
| Name: | Protein lin-28 homolog A |
|---|
| Synonyms: | LN28A_MOUSE | Lin-28A | Lin28 | Lin28a | Protein lin-28 homolog A | Testis-expressed protein 17 | Tex17 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22729.80 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_118142 |
|---|
| Residue: | 209 |
|---|
| Sequence: | MGSVSNQQFAGGCAKAAEKAPEEAPPDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
ERRPKGKNMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQ
GPSSQGKPAYFREEEEEIHSPALLPEAQN
|
|
|
|---|
| BDBM50345905 |
|---|
| n/a |
|---|
| Name | BDBM50345905 |
|---|
| Synonyms: | CHEMBL4167853 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19FN2O4S2 |
|---|
| Mol. Mass. | 434.504 |
|---|
| SMILES | Cc1ccc(cc1)S(=O)(=O)Nc1ccc(C)cc1NS(=O)(=O)c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
