| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Regulator of G-protein signaling 17 |
|---|
| Ligand | BDBM50071058 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1756644 (CHEMBL4191652) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Bodle, CR; Mackie, DI; Hayes, MP; Schamp, JH; Miller, MR; Henry, MD; Doorn, JA; Houtman, JCD; James, MA; Roman, DL Natural Products Discovered in a High-Throughput Screen Identified as Inhibitors of RGS17 and as Cytostatic and Cytotoxic Agents for Lung and Prostate Cancer Cell Lines. J Nat Prod80:1992-2000 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Regulator of G-protein signaling 17 |
|---|
| Name: | Regulator of G-protein signaling 17 |
|---|
| Synonyms: | RGS17 | RGS17_HUMAN | RGSZ2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24356.71 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_118219 |
|---|
| Residue: | 210 |
|---|
| Sequence: | MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
|
|
|
|---|
| BDBM50071058 |
|---|
| n/a |
|---|
| Name | BDBM50071058 |
|---|
| Synonyms: | (2R,4aS,6aS,12bR,14aS,14bR)-10-Hydroxy-2,4a,6a,9,12b,14a-hexamethyl-11-oxo-1,2,3,4,4a,5,6,6a,11,12b,13,14,14a,14b-tetradecahydro-picene-2-carboxylic acid | CELASTROL | CHEMBL301982 | cid_4274774 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H38O4 |
|---|
| Mol. Mass. | 450.6096 |
|---|
| SMILES | C[C@]12CC[C@](C)(C[C@H]1[C@]1(C)CC[C@]3(C)C(=CC=c4c3cc(O)c(O)c4=C)[C@@]1(C)CC2)C(O)=O |r,c:15,17| |
|---|
| Structure | 
|
|---|
Search and Browse
