| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Folate receptor alpha |
|---|
| Ligand | BDBM50457432 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1759621 (CHEMBL4194629) |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Ravindra, M; Wallace-Povirk, A; Karim, MA; Wilson, MR; O'Connor, C; White, K; Kushner, J; Polin, L; George, C; Hou, Z; Matherly, LH; Gangjee, A Tumor Targeting with Novel Pyridyl 6-Substituted Pyrrolo[2,3- d]Pyrimidine Antifolates via Cellular Uptake by Folate Receptor ? and the Proton-Coupled Folate Transporter and Inhibition of De Novo Purine Nucleotide Biosynthesis. J Med Chem61:2027-2040 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Folate receptor alpha |
|---|
| Name: | Folate receptor alpha |
|---|
| Synonyms: | Adult folate-binding protein | FBP | FOLR | FOLR1 | FOLR1_HUMAN | FR-alpha | Folate receptor 1 | Folate receptor, adult | KB cells FBP | Ovarian tumor-associated antigen MOv18 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29827.41 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1469596 |
|---|
| Residue: | 257 |
|---|
| Sequence: | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
|
|
|
|---|
| BDBM50457432 |
|---|
| n/a |
|---|
| Name | BDBM50457432 |
|---|
| Synonyms: | CHEMBL4205344 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N6O6 |
|---|
| Mol. Mass. | 456.4519 |
|---|
| SMILES | Nc1nc2[nH]c(CCCCc3ccc(cn3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)cc2c(=O)[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
