| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-5 |
|---|
| Ligand | BDBM50459538 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1766595 (CHEMBL4201842) |
|---|
| IC50 | 1100±n/a nM |
|---|
| Citation |  De Vita, E; Schüler, P; Lovell, S; Lohbeck, J; Kullmann, S; Rabinovich, E; Sananes, A; Heßling, B; Hamon, V; Papo, N; Hess, J; Tate, EW; Gunkel, N; Miller, AK Depsipeptides Featuring a Neutral P1 Are Potent Inhibitors of Kallikrein-Related Peptidase 6 with On-Target Cellular Activity. J Med Chem61:8859-8874 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-5 |
|---|
| Name: | Kallikrein-5 |
|---|
| Synonyms: | KLK5 | KLK5_HUMAN | Kallikrein 5 | SCTE | kallikrein-related peptidase 5 preproprotein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32031.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_12584 |
|---|
| Residue: | 293 |
|---|
| Sequence: | MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARS
DDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGH
YSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPS
AGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS
CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS
|
|
|
|---|
| BDBM50459538 |
|---|
| n/a |
|---|
| Name | BDBM50459538 |
|---|
| Synonyms: | CHEMBL4218203 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24N4O3 |
|---|
| Mol. Mass. | 416.4724 |
|---|
| SMILES | Cc1nn(c(C)c1NC(=O)COC(=O)Cc1c(C)[nH]c2ccccc12)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
