Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50459812 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1767095 (CHEMBL4202342) |
---|
IC50 | 444±n/a nM |
---|
Citation | Alexandre, FR; Rahali, R; Rahali, H; Guillon, S; Convard, T; Fillgrove, K; Lai, MT; Meillon, JC; Xu, M; Small, J; Dousson, CB; Raheem, IT Synthesis and Antiviral Evaluation of Carbocyclic Nucleoside Analogs of Nucleoside Reverse Transcriptase Translocation Inhibitor MK-8591 (4'-Ethynyl-2-fluoro-2'-deoxyadenosine). J Med Chem61:9218-9228 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50459812 |
---|
n/a |
---|
Name | BDBM50459812 |
Synonyms: | CHEMBL4214561 |
Type | Small organic molecule |
Emp. Form. | C12H17N6O12P3 |
Mol. Mass. | 530.2177 |
SMILES | Nc1nc2n(cnc2c(=O)[nH]1)C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)(C1)C#N |
Structure |
|