| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrix protein 2 |
|---|
| Ligand | BDBM50465107 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1784189 (CHEMBL4255706) |
|---|
| Kd | 3430±n/a nM |
|---|
| Citation |  Drakopoulos, A; Tzitzoglaki, C; McGuire, K; Hoffmann, A; Konstantinidi, A; Kolokouris, D; Ma, C; Freudenberger, K; Hutterer, J; Gauglitz, G; Wang, J; Schmidtke, M; Busath, DD; Kolocouris, A Unraveling the Binding, Proton Blockage, and Inhibition of Influenza M2 WT and S31N by Rimantadine Variants. ACS Med Chem Lett9:198-203 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Matrix protein 2 |
|---|
| Name: | Matrix protein 2 |
|---|
| Synonyms: | M | M2_I72A8 | Proton channel protein M2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11180.06 |
|---|
| Organism: | Influenza A virus (A/Udorn/307/1972(H3N2)) |
|---|
| Description: | ChEMBL_22 |
|---|
| Residue: | 97 |
|---|
| Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
|
|
|
|---|
| BDBM50465107 |
|---|
| n/a |
|---|
| Name | BDBM50465107 |
|---|
| Synonyms: | CHEMBL4292664 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H31N |
|---|
| Mol. Mass. | 249.4347 |
|---|
| SMILES | CCCC(N)(CCC)C12CC3CC(CC(C3)C1)C2 |TLB:11:12:16:9.10.15,THB:11:10:16:17.12.13,13:12:9:16.14.15,13:14:9:17.12.11| |
|---|
| Structure | 
|
|---|
Search and Browse
