| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transcriptional activator protein LasR |
|---|
| Ligand | BDBM50465703 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1788570 (CHEMBL4260304) |
|---|
| IC50 | 50000±n/a nM |
|---|
| Citation |  Soukarieh, F; Williams, P; Stocks, MJ; Cámara, M Pseudomonas aeruginosa Quorum Sensing Systems as Drug Discovery Targets: Current Position and Future Perspectives. J Med Chem61:10385-10402 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Transcriptional activator protein LasR |
|---|
| Name: | Transcriptional activator protein LasR |
|---|
| Synonyms: | LASR_PSEAE | lasR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26618.24 |
|---|
| Organism: | Pseudomonas aeruginosa |
|---|
| Description: | ChEMBL_1475312 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MALVDGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAW
REHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHG
ARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSR
EKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLITL
|
|
|
|---|
| BDBM50465703 |
|---|
| n/a |
|---|
| Name | BDBM50465703 |
|---|
| Synonyms: | CHEMBL1823945 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H14Cl2N2O2 |
|---|
| Mol. Mass. | 385.243 |
|---|
| SMILES | Clc1cccc(c1)C(=O)Nc1ccccc1NC(=O)c1cccc(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
